PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G395300.1.p
Common NameLOC101785318, SETIT_028797mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CAMTA
Protein Properties Length: 1030aa    MW: 114174 Da    PI: 5.5125
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G395300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1180.81.7e-56211362117
                CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenp 92 
                         l+ ++rwl+++ei++iL n++k++++ e+++rp+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v+vl+cyYah+e+n+
  Seita.2G395300.1.p  21 LEAQNRWLRPTEICQILSNYKKFSIAPEPPNRPPSGSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEDNE 111
                         5679*************************************************************************************** PP

                CG-1  93 tfqrrcywlLeeelekivlvhylev 117
                         +fqrr+ywlLee + +ivlvhyle 
  Seita.2G395300.1.p 112 NFQRRTYWLLEEGFMNIVLVHYLEI 136
                         **********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.24816142IPR005559CG-1 DNA-binding domain
SMARTSM010765.7E-7719137IPR005559CG-1 DNA-binding domain
PfamPF038591.1E-5022135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.108.8E-7443530IPR013783Immunoglobulin-like fold
PfamPF018336.7E-6444517IPR002909IPT domain
SuperFamilySSF812969.97E-18444530IPR014756Immunoglobulin E-set
SuperFamilySSF484031.71E-17621735IPR020683Ankyrin repeat-containing domain
CDDcd002042.16E-12622733No hitNo description
Gene3DG3DSA:1.25.40.201.0E-17635736IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029716.839642735IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008810.419675707IPR002110Ankyrin repeat
SMARTSM002480.0011675704IPR002110Ankyrin repeat
PfamPF000234.0E-5676706IPR002110Ankyrin repeat
SuperFamilySSF525409.82E-8847899IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.045848870IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.919849878IPR000048IQ motif, EF-hand binding site
PfamPF006120.0055850869IPR000048IQ motif, EF-hand binding site
SMARTSM000150.027871893IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.45872896IPR000048IQ motif, EF-hand binding site
PfamPF006127.9E-5874893IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1030 aa     Download sequence    Send to blast
MAEIRKYAMS NQPPDIAQIL LEAQNRWLRP TEICQILSNY KKFSIAPEPP NRPPSGSLFL  60
FDRKILRYFR KDGHNWRKKK DGKTVKEAHE KLKVGSVDVL HCYYAHGEDN ENFQRRTYWL  120
LEEGFMNIVL VHYLEIKGGK QNFNRAKEAE ENAGLSSADS PACSNSFASQ SQVASQSMDA  180
ESPISGQISE YEDAETDNCR ASSRYHPFTE MQQPVDGIMM SNFLGASAPS ASVNNLGAGY  240
LGEMQPTPAN FTNHFVTHDD ISSAFNETGA GLRGGPKTPI DSMRFGEPVP EYPGGFTEPT  300
LYSSVATVGN NLDDSLQTFM SEALYTNNLT QNEVDALNAA GITSSQAEND GYTDQSARYP  360
LLKQSSLDLF KIEPDGLKKF DSFSRWMSNE LAEVADLDIK SSSDAFWSTT ETVNVADGSS  420
IPINEQLDAF VVSPSLSQDQ LFSIIDVSPS WAYNGTKTKV LITGTFLAKK EDVENSRWSC  480
MFGDVEVAAE VLVDGSLRCY TPVHHSGRVP FYVTCSNRVA CSEVREFEFR DSETHYMETS  540
DPHTTGINEM HLHIRLDKLL SLGPEDYEKY VLSNGNKSEL VDTINSLMLD DKLSNMALSS  600
GEKELSTVRD QNVEKQVKEK LYYWLIHKIH DDGKGPNVLG KEGQGVIHLV AALGYDWAIK  660
PIVAAGVKVN FRDIRGWTAL HWAASCGRER TVGALIANGA DPGALTDPTQ QFPSATPADL  720
ASENGHKGIA GFLAESALTN HLSALTLKES QGGNVEEIGG LTAAEEFAEP SSAQLACVDS  780
QEESLKDSLG AVRKSTQAAA RIFQAFRVES FHRKKVIEYG DDDCGLSDER TLSLISLKNA  840
KPGHSDMPMH SAAVRIQNKF RGWKGRKEFM IIRQKIVKIQ AHVRGHNVRK NYRKVVWSVG  900
IVEKVILRWR RKRRGLRGFQ AEKQLEGPSS QIQPAKSEAE DEYDYLKDGR KQAEGRLQRA  960
LARVHSMTQY PEARDQYRRL QTCVNELQES QAMQDGMLSD AAGTDGGDLM AELEELCRGD  1020
GDAPMSTIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3059161e-155GQ305916.1 Pennisetum glaucum x Pennisetum squamulatum clone PsCMD3_0_246 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958362.10.0PREDICTED: calmodulin-binding transcription activator 3-like
TrEMBLK3ZQB70.0K3ZQB7_SETIT; Uncharacterized protein
STRINGSi028797m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1